PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462915562
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family B3
Protein Properties Length: 415aa    MW: 47334 Da    PI: 9.6874
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462915562genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B342.51.2e-131781797
               E--HHH.HTT...---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
         B3 17 vlpkkfaeeh...ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97
               ++p kf++++   +    +s t ++ +++g+ W+vk+  ++  +++++++GW +F   +g+ egD+++ +++g++ f  ++k+f
  462915562  1 MIPAKFVKQYvigE--YLNSPTAVVVSPQGKFWQVKV--ENDESGMFFSGGWPSFLAFHGISEGDILLMRYEGNMVF--KFKAF 78
               69********9742..3455699**************..999999****************************9999..66666 PP

2B362.66.4e-20153235186
                EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
         B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                ++k++++++ lk++ ++l+ kf++++g +k +++tl+ +  s rsW+v      + ++ +l++GWk+F+++n+LkegD+++F  ++
  462915562 153 WIKTEITNSRLKHK-MSLSSKFCSDIGFQKSCTITLKTNIDSTRSWKVHG--LAYNDARYLGDGWKKFCQDNRLKEGDVCTFNIVK 235
                78999*******98.***********99998987777777888*******..77777778**********************9765 PP

3B343.27.3e-14320398888
                -HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
         B3   8 sdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                 +  +s++++l   f+  +g++ ++ +tl+    s++ W+v +   kk g+y l++ W +F+++n+LkegD+++Fk+++++
  462915562 320 GMKKNSDLVYLAQAFFVGIGLQVPCIITLKTFIHSSKFWQVHV--IKKNGSYQLGEDWWRFCQDNRLKEGDICTFKVIQHE 398
                556677889999999999999988865555555888*******..899999*************************88543 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086313.155181IPR003340B3 DNA binding domain
CDDcd100172.16E-13179No hitNo description
SMARTSM010194.3E-5181IPR003340B3 DNA binding domain
SuperFamilySSF1019368.04E-15180IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.2E-14280IPR015300DNA-binding pseudobarrel domain
PfamPF023621.2E-10278IPR003340B3 DNA binding domain
SuperFamilySSF1019362.35E-19148247IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.7E-21148247IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.252152247IPR003340B3 DNA binding domain
PfamPF023624.6E-16153235IPR003340B3 DNA binding domain
SMARTSM010195.7E-9154247IPR003340B3 DNA binding domain
CDDcd100178.36E-13164231No hitNo description
SMARTSM010190.0025314410IPR003340B3 DNA binding domain
SuperFamilySSF1019366.67E-13317396IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.6E-12320397IPR015300DNA-binding pseudobarrel domain
PfamPF023625.4E-11323398IPR003340B3 DNA binding domain
CDDcd100171.18E-7343393No hitNo description
PROSITE profilePS508639.333346412IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 415 aa     Download sequence    Send to blast
MIPAKFVKQY VIGEYLNSPT AVVVSPQGKF WQVKVENDES GMFFSGGWPS FLAFHGISEG  60
DILLMRYEGN MVFKFKAFDL HGSLKDLNDQ GTRIKQNIGR QQEGHFCFPS RKRECNSENP  120
SCEENKRSKG STITLKKAST QKEPDYQTGP PSWIKTEITN SRLKHKMSLS SKFCSDIGFQ  180
KSCTITLKTN IDSTRSWKVH GLAYNDARYL GDGWKKFCQD NRLKEGDVCT FNIVKTMLWQ  240
VTITRSSTDN QMQQKSRPPH SDMECMNKND SSSIEELKGP NGSGTNLKKA SYTRSVYEIG  300
PPSWIQKEMT TASLQKNITG MKKNSDLVYL AQAFFVGIGL QVPCIITLKT FIHSSKFWQV  360
HVIKKNGSYQ LGEDWWRFCQ DNRLKEGDIC TFKVIQHEIR ETSPNISPSW RPVKS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGSi012086m2e-96(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42535187
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00260.11e-13B3 family protein